« Zurück
Startseite /
Recombinant Rabbit Vascular cell adhesion molecule 1

Recombinant Rabbit Vascular cell adhesion molecule 1

ArtNr	pro-361-2ug
Hersteller	ProSpec
Menge	2ug
Kategorie	Neuroscience Neuroinflammation Neural Adhesion Molecules Peptides & Proteins Recombinant Proteins
Typ	Proteins
Specific against	Rabbit (Oryctolagus cuniculus)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Similar products	rVCAM1
Lieferbar
Synonyms	Vascular cell adhesion protein 1, V-CAM 1, INCAM-100, CD106, VCAM1, L1CAM, MGC99561, DKFZp779G2333
Introduction	VCAM1 is a member of the Ig superfamily. It is a cell surface sialoglycoprotein expressed by cytokine activated endothelium. VCAM-1 contains 6 or 7 immunoglobulin domains, and is expressed on both large and small vessels only after the endothelial cells are stimulated by cytokines. The protein has a number of functions including the regulation of leukocyte migration, leukocyte endothelial cell adhesion and signal transduction and may play a role in a number of inflammatory diseases (artherosclerosis and rheumatoid arthritis).
Description	VCAM1 Rabbit Recombinant is expressed in insect cells and containing 674 amino acids (a.a. 25-698) fused to a N-terminal hexahistidine tag, having a total MW of 77.06kDa.
Source	Baculovirus sytem, insect cells.
Physical Appearance	Sterile Filtered colorless solution.
Formulation	The VCAM1 solution (1mg/ml) contains 50mM Tris, 300mM NaCl, 10% Glycerol, pH 7.5.
Purity	Greater than 90% as determined by SDS-PAGE.
Usage	ProSpec's products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.
Amino acid sequence	AFKIETFPESRSLAQIGDSVSLTCTTTGCASPTFSWRTQIDSPLNGKVRSEGTTSTLTMDPVSFENE HSYLCTATCESKKLEKGIQVEIYSFPKDPEIHLSGPLEVGEPITVKCLVPDVYPFDRLEVDLLKGDYLM KKQDFLEDMDRKSLETKSLEVTFIPVIEDIGKLIVCRAKLHIDEIDSEPKERETTKELQVYISPKNTVIS VNPSTRLQEGGSVTMTCSSEGLPVPEIFWSKKQDNGNLQRLSGNATLTLIAMRMEDSGIYVCEG VNQIGKSRKEVELIVQEKPFTVEISPGPRIAAQIGDPVVLTCSVRGCETPSFSWRTQIDSPLNGQVT SEGTKSLLTLSPVSFENEHSYLCTVTCGHKKLEKGIQVELYSFPRDPEIELSGPPVNGRPVTVSCKVP NVYPFDXLEIELLKGETMMKNKEFLEEEDKKSLETKSLEMTFIPTMEDTGKVLVCQAKLHIDEMEF EPKQRQSTQPLFVNVAPRDIAVWVSPSSIVEEGRSVNMTCSSYGLPAPKILWSRQLKNGDLQPLS ENTTLALISTKLEDSGIYVCEGINLAGKSRKEVELVIQVAPKDIQLTAFPSKSVKEGDTVIISCTCGNV PETWIILKKKAETGDTVLKSIDGAYTIRKAQLEDAGVYECESKNEVGSQLRSITLDVKGRENSKDYF SPE
Storage	VCAM1 although stable 4C for 4 weeks, should be stored desiccated below -18C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

Produkt-Datenblatt anfordern

pro-361-2ug-safety-datasheet.pdf