« Zurück
Startseite /
SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag

SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag

ArtNr	BOS-RCOV01
Hersteller	Boster
Menge	100 ug/vial
Quantity options	100 ug/vial
Kategorie	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Format	Lyophilized
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Konjugat/Tag	HIS
Sequence	SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SARS-CoV-2,COVID-19,2019-nCoV,NSP5A,Nonstructural Protein 5A
Lieferbar
Manufacturer - Category	Recombinant Proteins
Storage Conditions	The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular weight	34.6KD
Contents	Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Purification	> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining. Method of purification: Nickel column affinity purification
Description	SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only. Product is under validation for additional applications and indications.
Endotoxin level	Less than 1 EU/μg protein as determined by LAL method.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

BOS-RCOV01-datasheet.pdf

BOS-RCOV01-safety-datasheet.pdf