« Back
Home /
SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag

SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag

Item no.	BOS-RCOV01
Manufacturer	Boster
Amount	100 ug/vial
Quantity options	100 ug/vial
Category	Infectious Diseases Viral Infections Coronavirus (COVID-19) Peptides & Proteins Recombinant Proteins
Type	Proteins Recombinant
Format	Lyophilized
Specific against	Mouse (Murine, Mus musculus)
Host	E.coli
Conjugate/Tag	HIS
Sequence	SGFRKMAFPSGKVEGCMVQVTCGTTTLNGLWLDDVVYCPRHVICTSEDMLNPNYEDLLIRKSNHNFLVQAGNVQLRVIGHSMQNCVLKLKVDTANPKTPKYKFVRIQPGQTFSVLACYNGSPSGVYQCAMRPNFTIKGSFLNGSCGSVGFNIDYDCVSFCYMHHMELPTGVHAGTDLEGNFYGPFVDRQTAQAAGTDTTITVNVLAWLYAAVINGDRWFLNRFTTTLNDFNLVAMKYNYEPLTQDHVDILGPLSA
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SARS-CoV-2,COVID-19,2019-nCoV,NSP5A,Nonstructural Protein 5A
Available
Manufacturer - Category	Recombinant Proteins
Storage Conditions	The product is shipped at ambient temperature. Upon receipt, store it immediately at -20°C for 6 months under sterile conditions. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Calculated Molecular weight	34.6KD
Contents	Lyophilized from sterile 20mM PB, 150mM NaCl, PH 7.3-7.4, 10% glycerol and 4% trehalose
Purification	> 90%. Purification measurement method by SDS-PAGE quantitative densitometry by Coomassie? Blue Staining. Method of purification: Nickel column affinity purification
Description	SARS-CoV-2 (COVID-19) NSP5A Protein, His Tag is produced in E. coli and has a theoretical molecular weight of 34.6KD. This product is for research use only. Product is under validation for additional applications and indications.
Endotoxin level	Less than 1 EU/μg protein as determined by LAL method.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

BOS-RCOV01-datasheet.pdf

BOS-RCOV01-safety-datasheet.pdf