Vergleich

Recombinant Human B- and T-lymphocyte attenuator(BTLA),partial (Active)

ArtNr CSB-MP773799HU-20
Hersteller Cusabio
Menge 20 ug
Quantity options 100 ug 1 mg 20 ug 500 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Host Mammalian cells
Konjugat/Tag Myc
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Citations "CD160 inhibits activation of human CD4+ T cells through interaction with herpesvirus entry mediator." Cai G., Anumanthan A., Brown J.A., Greenfield E.A., Zhu B., Freeman G.J. Nat. Immunol. 9:176-185(2008)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B- and T-lymphocyte-associated protein (CD272)
Lieferbar
Manufacturer - Type
Protein
Manufacturer - Conjugate / Tag
C-terminal hFc-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43, 9
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Relevance
Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis or in trans with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells .
Expression Region
31-150aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
BTLA
Sequence Info
Partial
Manufacturer - Format
Liquid or Lyophilized powder

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 20 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen