Comparison

Recombinant Human B- and T-lymphocyte attenuator(BTLA),partial (Active)

Item no. CSB-MP773799HU-20
Manufacturer Cusabio
Amount 20 ug
Quantity options 100 ug 1 mg 20 ug 500 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Host Mammalian cells
Conjugate/Tag Myc
Purity Greater than 90% as determined by SDS-PAGE.
Sequence KESCDVQLYIKRQSEHSILAGDPFELECPVKYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQSNLIESHSTTLYVTDVKSASERPSKDEMAS
Citations "CD160 inhibits activation of human CD4+ T cells through interaction with herpesvirus entry mediator." Cai G., Anumanthan A., Brown J.A., Greenfield E.A., Zhu B., Freeman G.J. Nat. Immunol. 9:176-185(2008)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias B- and T-lymphocyte-associated protein (CD272)
Available
Manufacturer - Type
Protein
Manufacturer - Conjugate / Tag
C-terminal hFc-Myc-tagged
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C.
Molecular Weight
43, 9
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
General Research Areas
Immunology
Relevance
Inhibitory receptor on lymphocytes that negatively regulates antigen receptor signaling via PTPN6/SHP-1 and PTPN11/SHP-2. May interact in cis or in trans with TNFRSF14. In cis interactions, appears to play an immune regulatory role inhibiting in trans interactions in naive T cells to maintain a resting state. In trans interactions, can predominate during adaptive immune response to provide survival signals to effector T cells .
Expression Region
31-150aa
Protein Length
Partial
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
Gene Names
BTLA
Sequence Info
Partial
Manufacturer - Format
Liquid or Lyophilized powder

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 20 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close