Vergleich

Interleukin-25/IL-25

ArtNr NOVP-C092-10ug
Hersteller Novoprotein Scientific
Menge 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins
Specific against Human (Homo sapiens)
Host E.coli
Sequence YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPE SCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLC PHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTH KGYCLERRLYRVSLACVCVRPRVMG
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Similar products il-25
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Description
Recombinant Human Interleukin-25/IL-25 is produced with our E. coli expression system. The target protein is expressed with sequence (Tyr33-Gly177) of Human IL-25.
Formulation
Lyophilized from a 0.2 uM filtered solution of 20mM PB, 150mM NaCl, pH 7.2
Background
Interleukin 25 (IL-25) belongs to the Interleukin 17 (IL-17) family of proteins, which is comprised of six members (IL-17, IL-17B through IL-17F). These proteins are secreted & are structurally related by sharing a conserved cysteine-knot fold near the C-terminus, but have considerable sequence divergence at the N-terminus. With the exception of IL-17B, which exists as a non-covalently linked dimer, all IL-17 family members are disulfide-linked dimers. IL-17 family proteins are pro-inflammatory cytokines that induce local cytokine production & are involved in the regulation of immune functions. Human interleukin-17E (IL17E), also referred to as Interleukin-25 (IL25), is a distinct member of the IL17 cytokine family comprised of at least six members sharing a conserved cysteine-knot structure but divergent at the N-terminus. IL25 is a glycoprotein secreted as dimers by innate effector eosinophils & basophils, & present at very low levels in various peripheral tissues. IL25, together with IL17B, are ligands for the cytokine receptor IL17BR, & the cross-linking induces NF-kappaB activation & production of the proinflammatory chemokine IL-8, as well as ERK, JNK, & p38 activation. Overexpression of IL25 gene in transgenic mice suggested that this cytokine can regulate hematopoietic & immune functions, & additionally is identified as a proinflammatory cytokine favoring Th2-type immune responses possibly by enhancing the maintenance & functions of adaptive Th2 memory cells. Human IL-17E cDNA encodes a 177 amino acid residues precursor protein with a putative 32 amino acid signal peptide. A second isoform of human IL-17E encoding a 161 amino acid precursor protein also exists.
uName
il-25

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen