Vergleich

[Novoprotein] Recombinant Human C-X-C Motif Chemokine 11/CXCL11

ArtNr NOVP-C119-10ug
Hersteller Novoprotein Scientific
Menge 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host E.coli
Konjugat/Tag Unconjugated
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence MFPMFKRGRCLCIGPGVKAVKVADIEKASIMYPSN NCDKIEVIITLKENKGQRCLNPKSKQARLIIKKVE RKNF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-X-C Motif Chemokine 11,Beta-R1,H174,Interferon Gamma-Inducible Protein 9,IP-9,Interferon-Inducible T-Cell Alpha Chemoattractant,I-TAC,Small-Inducible Cytokine B11,CXCL11,ITAC,SCYB11,SCYB9B
Similar products cxcl11
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
8, 44
Description
Recombinant Human C-X-C Motif Chemokine 11 is produced by our E.coli expression system & the target gene encoding Phe22-Phe94 is expressed.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM TrisHCl, 2.5mM EDTA, 500mM NaCl, pH 9.0.
Background
Chemokine Ligand 11 (CXCL11) is a non-ELR (lacking the Glu-Leu-Arg tripeptide motif) CXC chemokine. CXCL11 is highly expressed in peripheral blood leukocytes, pancreas & liver, with moderate levels in thymus, spleen & lung & low expression levels were in small intestine, placenta & prostate. Gene expression of CXCL11 is strongly induced by IFN-gamma & IFN-beta, & weakly induced by IFN-alpha. This chemokine elicits its effects on its target cells by interacting with the cell surface chemokine receptor CXCR3, with a higher affinity than do the other ligands for this receptor, CXCL9 & CXCL10. CXCL11 is chemotactic for activated T cells. Its gene is located on human chromosome 4 along with many other members of the CXC chemokine family. CXCL11 cDNA encodes a 94 amino acid residue precursor protein with a 21 amino acid residue putative signal sequence, which is cleaved to form the mature 73 amino acid residue protein. CXCL11 shares 36% & 37% amino acid sequence homology with IP-10 & MIG (two other known human non-ELR CXC chemokines), respectively. Mouse CXCL11 exhibits 68% sequence homology with humanCXCL11. In humans, CXCL11, IP-10 & MIG all map to the same locus on chromosome 4.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Phe22-Phe94

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen