Vergleich

[Novoprotein] Recombinant Mouse Nerve Growth Factor Receptor/NGFR/TNFRSF16/CX271 (C-Fc)

ArtNr NOVP-C787-50ug
Hersteller Novoprotein Scientific
Menge 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Konjugat/Tag Fc
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence GAKETCSTGMYTHSGECCKACNLGEGVAQPCGANQ TVCEPCLDSVTFSDVVSATEPCKPCTECLGLQSMS APCVEADDAVCRCSYGYYQDEETGRCEACSVCGVG SGLVFSCQDKQNTVCEECPEGTYSDEANHVDPCLP CTVCEDTERQLRECTPWADAECEEIPGRWITRSTP PEGSDVTTPSTQEPEAPPERDLIASTVADTVTTVM GSSQPVVTRGTADNVDDIEGRMDEPKSCDKTHTCP PCP
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Nerve growth factor receptor (TNFR superfamily,member 16),Tumor necrosis factor receptor superfamily member 16,Ngfr
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
56, 15
Description
Recombinant Mouse Nerve Growth Factor Receptor is produced by our Mammalian expression system & the target gene encoding Gly20-Asn243 is expressed with a Fc tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
Mouse Tumor necrosis factor receptor superfamily member 16(TNFRSF16) is a single-pass type I membrane protein which contains 1 death domain & 4 TNFR-Cys repeats. It has low affinity receptor which can bind to NGF, BDNF, NT-3, & NT-4. It can mediate cell survival as well as cell death of neural cells. TNFRSF16 plays a role in the regulation of the translocation of GLUT4 to the cell surface in adipocytes & skeletal muscle cells in response to insulin, probably by regulating RAB31 activity, & thereby contributes to the regulation of insulin-dependent glucose uptake. It binds to rabies virus glycoprotein Gs. Necessary for the circadian oscilllation of the clock genes ARNTL/BMAL1, PER1, PER2 & NR1D1 in the suprachiasmatic nucleus (SCN) of the brain & in liver & of the genes involved in glucose & lipid metabolism in the liver.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Gly20-Asn243

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen