Vergleich

[Novoprotein] Recombinant Human Interleukin-27/IL-27 (C-6His)

ArtNr NOVP-CB65-10ug
Hersteller Novoprotein Scientific
Menge 10 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence RKGPPAALTLPRVQCRASRYPIAVDCSWTLPPAPN STSPVSFIATYRLGMAARGHSWPCLQQTPTSTSCT ITDVQLFSMAPYVLNVTAVHPWGSSSSFVPFITEH IIKPDPPEGVRLSPLAERQLQVQWEPPGSWPFPEI FSLKYWIRYKRQGAARFHRVGPIEATSFILRAVRP RARYYVQVAAQDLTDYGELSDWSLPATATMSLGKG GGGSGGGGSGGGGSFPRPPGRPQLSLQELRREFTV SLH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin-27 subunit alpha,IL-27 subunit alpha,IL-27-A,IL27-A,p28,Il27,Il27a,Interleukin-27 subunit beta,Ebi3,IL-27 subunit beta,IL-27B,Epstein-Barr virus-induced gene 3 protein homolog,Ebi3,Il27b
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
Ambient
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
49.8kD
Description
Recombinant Human Interleukin-27 is produced by our Mammalian expression system & the target gene encoding Arg21-Lys229&Phe29-Pro243 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Background
IL-27 is a heterodimeric cytokine which belongs to the IL-6/IL-12 family of long type I cytokines. It is expressed on monocytes, endothelial cells & dendritic cells. IL-27 is an early product of activated antigen-presenting cells & drives rapid clonal expansion of naive CD4(+) T cells & plays a role in the early regulation of Th1 cells initiation which drives efficient adaptive immune response. IL-27 potentiates the early phase of TH1 response & suppresses TH2 & TH17 differentiation. It induces the differentiation of TH1 cells via two distinct pathways, p38 MAPK/TBX21- & ICAM1/ITGAL/ERK-dependent pathways. It also induces STAT1, STAT3, STAT4 & STAT5 phosphorylation & activates TBX21/T-Bet via STAT1 with resulting IL12RB2 up-regulation, an event crucial to TH1 cell commitment. IL-27 has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling. Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy. IL-27 reveals to be a potent inhibitor of TH17 cell development & of IL-17 production. Indeed IL27 alone is also able to inhibit the production of IL17 by CD4 & CD8 T-cells. IL-27 has also an effect on cytokine production. It suppresses proinflammatory cytokine production such as IL2, IL4, IL5 & IL6 & activates suppressors of cytokine signaling such as SOCS1 & SOCS3. Apart from suppression of cytokine production, IL-27 also antagonizes the effects of some cytokines such as IL6 through direct effects on T-cells. Another important role of IL-27 is its antitumor activity as well as its antiangiogenic activity with activation of production of antiangiogenic chemokines such as IP-10/CXCL10 & MIG/CXCL9.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen