Vergleich

Recombinant Human Regenerating Islet-Derived Protein 4/RELP (C-6His)

ArtNr NOVP-CD30-1mg
Hersteller Novoprotein Scientific
Menge 1 mg
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence DIIMRPSCAPGWFYHKSNCYGYFRKLRNWSDAELE CQSYGNGAHLASILSLKEASTIAEYISGYQRSQPI WIGLHDPQKRQQWQWIDGAMYLYRSWSGKSMGGNK HCAEMSSNNNFLTWSSNECNKRQHFLCKYRPVDHH HHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Regenerating islet-derived protein 4,Gastrointestinal secretory protein,REG-like protein,Regenerating islet-derived protein IV,GISP,RELP,REG4
Similar products REG4
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
19, 2
Description
Recombinant Human Regenerating islet-derived protein 4 is produced by our Mammalian expression system & the target gene encoding Asp23-Pro158 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Background
REG4 is a secreted contains one C-type lectin domain, high expressed in the gastrointestinal tract, including jejunum, ileum, appendix, pancreas & small intestine. REG4 can be up-regulated by mucosal injury from active Crohn's disease or ulcerative colitis. In the acid environment, REG4 can maintain carbohydrate recognition activity. REG4 may be involved in inflammatory & metaplastic response of the gastrointestinal epithelium.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Asp23-Pro158

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1 mg
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen