ArtNr |
NOVP-CK30-50ug |
Hersteller |
Novoprotein Scientific
|
Menge |
50 ug |
Quantity options |
10 ug
1 mg
500 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Format |
Lyophilized |
Specific against |
Human (Homo sapiens) |
Host |
Human |
Konjugat/Tag |
HIS |
Purity |
Greater than 95% as determined by reducing SDS-PAGE. |
Sequence |
QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKP YARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQL WMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLG CVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRT GPCRQRAVMETIAVGCTCIFVDHHHHHH |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17B, interleukin-17 beta, interleukin-17B, interleukin 17B, IL20, IL-20, interleukin 20 Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-Cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17Binterleukin-17 beta, IL20, IL-20interleukin-17B, interleukin 17B, interleukin 20, Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin- |
Lieferbar |
|
Background |
Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses & inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E & IL-17F. The six IL-17 cytokines are highly conserved at C terminus, & contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine & chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) & induces the production of inflammatory cytokines & the infiltration of inflammatory immune cells. |
Description |
Recombinant Human Interleukin-17B is produced by our Mammalian expression system & the target gene encoding Gln21-Phe180 is expressed with a 6His tag at the C-terminus. |
Endotoxin |
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test. |
Formulation |
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4. |
Molecular Weight |
19, 2 |
Reconstitution |
Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 ug/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Seq Length |
Gln21-Phe180 |
Ship Description |
The product is shipped at ambient temperature. |
Storage |
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7C for 2-7 days. Aliquots of reconstituted samples are stable at < -20C for 3 months. |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.