Comparison

[Novoprotein] Recombinant Human Interleukin-17B/IL-17B (C-6His)

Item no. NOVP-CK30-50ug
Manufacturer Novoprotein Scientific
Amount 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence QPRSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKP YARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQL WMSNKRSLSPWGYSINHDPSRIPVDLPEARCLCLG CVNPFTMQEDRSMVSVPVFSQVPVRRRLCPPPPRT GPCRQRAVMETIAVGCTCIFVDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17B, interleukin-17 beta, interleukin-17B, interleukin 17B, IL20, IL-20, interleukin 20 Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-Cytokine Zcyto7, cytokine-like protein ZCYTO7, IL-17Binterleukin-17 beta, IL20, IL-20interleukin-17B, interleukin 17B, interleukin 20, Interleukin-20, MGC138900, MGC138901, neuronal interleukin-17 related factor, Neuronal interleukin-17-related factor, NIRF, ZCYTO7interleukin-
Available
Background
Interleukin-17B (IL-17B) is a member of IL-17 cytokines family that plays important roles in host defence responses & inflammatory diseases. In addition to IL-17B, members of the IL-17 family include IL-17A, IL-17C, IL-17D, IL-17E & IL-17F. The six IL-17 cytokines are highly conserved at C terminus, & contain five spatially conserved cysteine residues that mediate dimerization. Expression of IL-17B protein has been reported in neurons, testis, ovary, stomach, pancreas, small intestine & chondrocytes. IL-17B binds to Interleukine-17 receptor B (IL-17 RB) & induces the production of inflammatory cytokines & the infiltration of inflammatory immune cells.
Description
Recombinant Human Interleukin-17B is produced by our Mammalian expression system & the target gene encoding Gln21-Phe180 is expressed with a 6His tag at the C-terminus.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Formulation
Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.4.
Molecular Weight
19, 2
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Seq Length
Gln21-Phe180
Ship Description
The product is shipped at ambient temperature.
Storage
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close