Vergleich

Recombinant Human Bone Morphogenetic Protein 9/BMP-9/GDF-2 (C-6His)

ArtNr NOVP-CK38-50ug
Hersteller Novoprotein Scientific
Menge 50 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Human (Homo sapiens)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence SAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAY ECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVG KACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVA ECGCR
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GDF2,GDF-2,BMP9,BMP-9,Bone morphogenetic protein 9,GDF-2,growth differentiation factor 2,growth/differentiation factor 2
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
12, 1
Description
Recombinant Human Growth & differentiation factor 2 is produced by our Mammalian expression system & the target gene encoding Ser320-Arg429 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of 4 mM HCl.
Background
Bone morphogenetic protein 9 (BMP9), also known as growth differentiation factor-2, is a member of the TGFbeta superfamily proteins that bind to type II & type I serine-threonine kinase receptors, & transduces signals through Smad & non-Smad signalling pathways. BMP9 has been shown to be a potent synergistic factor for hematopoietic progenitor generation & colony formation & may play a role in the induction & maintenance of the neuronal cholinergic phenotype in the central nervous system. ALK1 & ALK2 are important receptors for BMP9-induced osteogenic differentiation both in vitro & in vivo. BMP9 is highly expressed in the developing mouse liver, & recombinant human BMP9 stimulates hepatocyte proliferation.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Ser320-Arg429

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen