Vergleich

[Novoprotein] Recombinant Mouse Dickkopf-Like Protein 1/DkkL1/Soggy-1 (C-6His)

ArtNr NOVP-CK99-500ug
Hersteller Novoprotein Scientific
Menge 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Konjugat/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence LPIHDVDSQQNTSGFLGLQRLLQSFSRLFLKNDLL RDLDNFFSSPMDFRDLPRNFHQEENQEHRMGNHTL SSHLQIDKVTDNQTGEVLISEKVEASIEPERNPEG DWKVPKVEAKEPPVPVQKVTDSLHPEPRQVAFWIM KMPRRRTQPDVQDGGRWLIEKRHRMQAIRDGLRGG AREDSLEDGVHIPQHAKLPVRKTHFLYILRPSQQL VDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Dickkopf-like protein 1,Protein soggy-1,SGY-1,Dkkl1,Soggy-1
Versandbedingung Raumtemperatur
Lieferbar
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
25, 5
Description
Recombinant Mouse Dickkopf-like protein 1 is produced by our Mammalian expression system & the target gene encoding Leu21-Leu230 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
The glycoprotein Dickkopf-like1, also known as soggy-1, is a member of Dickkopf (Dkk) family which modulates Wnt signaling by binding to the Wnt co-receptor lipoprotein receptor-related protein (Lrp) via two Cys-rich regions. Dkkl1 shows unique homology to a discrete region in Dkk3, however, it lacks the Lrp binding region that enables Wnt modulation. Dkkl1 expression is gradually upregulated during the development of mouse testis & corresponds to the mouse spermatogenesis. Mouse Dkkl1 is detected in the embryo, as well as in the developing skeleton, eyes & neural tissue. In adult animals the expression of Dkkl1 is specific for spermatocytes & spermatids, where it regulates spermatocyte apoptosis mediated by Fas death ligand (FasL). Dkkl1 plays a critical role in male mammalian spermatogenesis.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Leu21-Leu230

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 500 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen