Comparison

[Novoprotein] Recombinant Mouse Dickkopf-Like Protein 1/DkkL1/Soggy-1 (C-6His)

Item no. NOVP-CK99-500ug
Manufacturer Novoprotein Scientific
Amount 500 ug
Quantity options 10 ug 1 mg 500 ug 50 ug
Category
Type Proteins Recombinant
Format Lyophilized
Specific against Mouse (Murine, Mus musculus)
Host Human
Conjugate/Tag HIS
Purity Greater than 95% as determined by reducing SDS-PAGE.
Sequence LPIHDVDSQQNTSGFLGLQRLLQSFSRLFLKNDLL RDLDNFFSSPMDFRDLPRNFHQEENQEHRMGNHTL SSHLQIDKVTDNQTGEVLISEKVEASIEPERNPEG DWKVPKVEAKEPPVPVQKVTDSLHPEPRQVAFWIM KMPRRRTQPDVQDGGRWLIEKRHRMQAIRDGLRGG AREDSLEDGVHIPQHAKLPVRKTHFLYILRPSQQL VDHHHHHH
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Dickkopf-like protein 1,Protein soggy-1,SGY-1,Dkkl1,Soggy-1
Shipping Condition Room temperature
Available
Shipping Temperature
The product is shipped at ambient temperature.
Storage Conditions
Lyophilized protein should be stored at < -20C, though stable at room temperature for 3 weeks.
Reconstituted protein solution can be stored at 4-7C for 2-7 days.
Aliquots of reconstituted samples are stable at < -20C for 3 months.
Molecular Weight
25, 5
Description
Recombinant Mouse Dickkopf-like protein 1 is produced by our Mammalian expression system & the target gene encoding Leu21-Leu230 is expressed with a 6His tag at the C-terminus.
Formulation
Lyophilized from a 0.2 um filtered solution of PBS, pH7.4.
Background
The glycoprotein Dickkopf-like1, also known as soggy-1, is a member of Dickkopf (Dkk) family which modulates Wnt signaling by binding to the Wnt co-receptor lipoprotein receptor-related protein (Lrp) via two Cys-rich regions. Dkkl1 shows unique homology to a discrete region in Dkk3, however, it lacks the Lrp binding region that enables Wnt modulation. Dkkl1 expression is gradually upregulated during the development of mouse testis & corresponds to the mouse spermatogenesis. Mouse Dkkl1 is detected in the embryo, as well as in the developing skeleton, eyes & neural tissue. In adult animals the expression of Dkkl1 is specific for spermatocytes & spermatids, where it regulates spermatocyte apoptosis mediated by Fas death ligand (FasL). Dkkl1 plays a critical role in male mammalian spermatogenesis.
Endotoxin
Less than 0.1 ng/ug (1 IEU/ug) as determined by LAL test.
Reconstitution
Always centrifuge tubes before opening. Do not mix by vortex or pipetting.
It is not recommended to reconstitute to a concentration less than 100 ug/ml.
Dissolve the lyophilized protein in ddH2O.
Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Sequence Length
Leu21-Leu230

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 500 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close