« Zurück
Startseite /
Recombinant Human TROP-2/TACSTD2 Protein

Recombinant Human TROP-2/TACSTD2 Protein

ArtNr	RP00423-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	100 ug 10 ug 50 ug
Kategorie	Oncology By Cell Type Carcinoma Peptides & Proteins Recombinant Proteins
Typ	Proteins Recombinant
Specific against	Human (Homo sapiens)
Purity	> 95% by SDS-PAGE;> 95% by HPLC
Sequence	QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVN
NCBI	TROP-2/TACSTD2
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	EGP1,EGP-1,TROP2,GA733-1,gp50,T16,TACSTD2,TROP-2,M1S1,TACD2
Lieferbar
Manufacturer - Applications	< 1 EU/μg of the protein by LAL method
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	28.9 kDa
Description	Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Thr274) of Human TROP-2/TACSTD2 (Accession #P09758) fused with a C-His tag at the C-terminus.
Background	Trop-2, also known as epithelial glycoprotein-1 antigen (EGP-1), is a protein that in humans is encoded by the TACSTD2 gene.Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	His27-Thr274
Route	C-His
Endotoxin	< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area	Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq	HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Bioactivity	Measured by the ability of the immobilized protein to support the adhesion of BCE C/D-1b bovine corneal endothelial cells. When 5 x 10⁴ cells per well are added to Recombinant Human Lumican/LUM coated plates (10 μg/mL, 100 μL/well), >35% will adhere after 50 minutes at 37 °C.
Protein Formulation	Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size	28.9 kDa
Gene Symbol	TROP-2/TACSTD2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00423-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern