Comparison

Recombinant Human TROP-2/TACSTD2 Protein European Partner

Item no. RP00423-50ug
Manufacturer Abclonal
Amount 50 ug
Quantity options 100 ug 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE;> 95% by HPLC
Sequence QYYDYDFPLSIYGQSSPNCAPECNCPESYPSAMYCDELKLKSVPMVPPGIKYLYLRNNQIDHIDEKAFENVTDLQWLILDHNLLENSKIKGRVFSKLKQLKKLHINHNNLTESVGPLPKSLEDLQLTHNKITKLGSFEGLVNLTFIHLQHNRLKEDAVSAAFKGLKSLEYLDLSFNQIARLPSGLPVSLLTLYLDNNKISNIPDEYFKRFNALQYLRLSHNELADSGIPGNSFNVSSLVELDLSYNKLKNIPTVN
NCBI TROP-2/TACSTD2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias EGP1,EGP-1,TROP2,GA733-1,gp50,T16,TACSTD2,TROP-2,M1S1,TACD2
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
28.9 kDa
Description
Recombinant Human TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His27-Thr274) of Human TROP-2/TACSTD2 (Accession #P09758) fused with a C-His tag at the C-terminus.
Background
Trop-2, also known as epithelial glycoprotein-1 antigen (EGP-1), is a protein that in humans is encoded by the TACSTD2 gene.Mutations of this gene result in gelatinous drop-like corneal dystrophy, an autosomal recessive disorder characterized by severe corneal amyloidosis leading to blindness.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
His27-Thr274
Route
C-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Biosimilar Drug Targets, Bio-Markers & CD Antigens
Antigen Seq
HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT
Bioactivity
Measured by the ability of the immobilized protein to support the adhesion of BCE C/D-1b bovine corneal endothelial cells. When 5 x 104 cells per well are added to Recombinant Human Lumican/LUM coated plates (10 μg/mL, 100 μL/well), >35% will adhere after 50 minutes at 37 °C.
Protein Formulation
Lyophilized from 0.22 μm filtered solution in PBS (pH 7.4). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
28.9 kDa
Gene Symbol
TROP-2/TACSTD2

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 50 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close