Vergleich

Recombinant Mouse TNFRSF3/Lymphotoxin beta R Protein Europäischer Partner

ArtNr RP00599-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 10 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
Sequence SQPQLVPPYRIENQTCWDQDKEYYEPMHDVCCSRCPPGEFVFAVCSRSQDTVCKTCPHNSYNEHWNHLSTCQLCRPCDIVLGFEEVAPCTSDRKAECRCQPGMSCVYLDNECVHCEEERLVLCQPGTEAEVTDEIMDTDVNCVPCKPGHFQNTSSPRARCQPHTRCEIQGLVEAAPGTSYSDTICKNPPEP
NCBI TNFRSF3/Lymphotoxin beta R
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Tumor necrosis factor receptor superfamily member 3,Lymphotoxin-betareceptor,Ltbr,Tnfcr,Tnfrsf3
Lieferbar
Manufacturer - Category
Proteins
Storage Conditions
Store the lyophilized protein at -20°C to -80 °C for long term.
After reconstitution, the protein solution is stable at -20 °C for 3 months, at 2-8 °C for up to 1 week.
Description
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Background
It is a single-pass type I membrane protein and contains 4 TNFR-Cys repeats. The protein is a member of thetumor necrosis factor (TNF) family of receptors. It is expressed on the surface of most cell types, including cellsof epithelial and myeloid lineages, but not on T and B lymphocytes. The protein is the receptor for theheterotrimeric lymphotoxin containing LTA and LTB, and for TNFS14/LIGHT. It promotes apoptosis via TRAF3and TRAF5 and may play a role in the development of lymphoid organs. The encoded protein and its ligandplay a role in the development and organization of lymphoid tissue and transformed cells. Activation of theencoded protein can trigger apoptosis. Not only does the TNFRSF3 help trigger apoptosis, it can lead to therelease of the cytokine interleukin 8. Overexpression of TNFRSF3 in Human Cells cells increases IL-8 promoteractivity and leads to IL-8 release. TNFRSF3 is also essential for development and organization of the secondarylymphoid organs and chemokine release.
Immunogen
Ser28-Pro218
Route
C-Fc
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen