Vergleich

Recombinant Human Macrophage migration inhibitory factor/MIF Protein Europäischer Partner

ArtNr RP02895LQ-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 10 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by reducing SDS-PAGE;> 95% by SEC-HPLC
Dry ice Yes
Sequence MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
NCBI Macrophage migion inhibitory factor/MIF
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias GIF,GLIF,MMIF,MIF,GLIF,MMIF
Versandbedingung Trockeneis
Lieferbar
Manufacturer - Category
Cytokines
Shipping Temperature
dry ice
Storage Conditions
Store at ≤-70°C, stable for 6 months after receipt. Store at ≤-70°C, stable for 3 months under sterile conditions after opening. Please minimize freeze-thaw cycles.
Description
Recombinant human Macrophage migration inhibitory factor/MIF Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Ala115) of human Macrophage migration inhibitory factor/MIF (Accession #NP_002406.1) fused with a 6xHis tag at the N-terminus.
Background
MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12).
Immunogen
Met1-Ala115
Route
N-His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Other Recombinant Protein
Protein Formulation
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH7.4.

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen