Item no. |
RP02895LQ-10ug |
Manufacturer |
Abclonal
|
Amount |
10 ug |
Quantity options |
10 ug
50 ug
|
Category |
|
Type |
Proteins Recombinant |
Specific against |
Human (Homo sapiens) |
Purity |
> 95% by reducing SDS-PAGE;> 95% by SEC-HPLC |
Dry ice |
Yes
|
Sequence |
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA |
NCBI |
Macrophage migion inhibitory factor/MIF |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
GIF,GLIF,MMIF,MIF,GLIF,MMIF |
Shipping condition |
Dry ice |
Available |
|
Manufacturer - Category |
Cytokines |
Shipping Temperature |
dry ice |
Storage Conditions |
Store at ≤-70°C, stable for 6 months after receipt. Store at ≤-70°C, stable for 3 months under sterile conditions after opening. Please minimize freeze-thaw cycles. |
Description |
Recombinant human Macrophage migration inhibitory factor/MIF Protein is produced by E.coli expression system. The target protein is expressed with sequence (Met1-Ala115) of human Macrophage migration inhibitory factor/MIF (Accession #NP_002406.1) fused with a 6xHis tag at the N-terminus. |
Background |
MIF (or macrophage migration inhibitory factor) was the first lymphokine/cytokine to be recognized in the pregenomics era (1, 2). Regardless, it is one of the least understood of all inflammatory mediators (1, 3). Human MIF is a 12.5 kDa, 115 amino acid (aa) nonglycosylated polypeptide that is synthesized without a signal sequence (4 - 7). Secretion occurs nonclassically via an ABCA1 transporter (8). The initiating Met is removed, leaving Pro as the first amino acid. The molecule consists of two alpha -helices and six beta -strands, four of which form a beta -sheet. The two remaining beta -strands interact with other MIF molecules, creating a trimer (2, 9, 10). Structure-function studies suggest MIF is bifunctional with segregated topology. The N- and C-termini mediate enzyme activity (in theory). Phenylpyruvate tautomerase activity (enol-to-keto) has been demonstrated and is dependent upon Pro at position #1 (11). Amino acids 50 - 65 have also been suggested to contain thiol-protein oxidoreductase activity (12). |
Immunogen |
Met1-Ala115 |
Route |
N-His |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Other Recombinant Protein |
Protein Formulation |
Supplied as a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, 50% Glycerol, pH7.4. |
Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.
All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.