« Zurück
Home /
Mouse Anti-Human PTEN

Mouse Anti-Human PTEN

ArtNr	101-11347
Hersteller	Raybiotech
Menge	100 ug
Quantity options	100 ug 100 ug 20 ug 200 ug 500 ug
Kategorie	Antibodies Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Typ	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applikationen	WB, ELISA, PLA
Clon	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHK QNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI DSICSIERADNDKEYLVLTL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PTEN
Lieferbar
Specificity	Human
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration	12 months from the date of shipment when stored properly.
Format	In 1x PBS, pH 7.2
Gene Symbols	PTEN
Protein Name & Synonyms	PTEN
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Clonality	Monoclonal

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.