« Back
Home /
Mouse Anti-Human PTEN

Mouse Anti-Human PTEN

Item no.	101-11347
Manufacturer	Raybiotech
Amount	100 ug
Quantity options	100 ug 100 ug 20 ug 200 ug 500 ug
Category	Antibodies Western Blot ELISA Primary Antibodies Proximity Ligation Analysis
Type	Antibody Monoclonal
Format	In 1x PBS, pH 7.2
Applications	WB, ELISA, PLA
Clone	Monoclonal
Specific against	Human (Homo sapiens)
Host	Hamster - Armenian
Isotype	IgG2a Kappa
Sequence	KVKIYSSNSGPTRREDKFMYFEFPQPLPVCGDIKVEFFHK QNKMLKKDKMFHFWVNTFFIPGPEETSEKVENGSLCDQEI DSICSIERADNDKEYLVLTL
ECLASS 10.1	42030590
ECLASS 11.0	42030590
UNSPSC	12352203
Similar products	PTEN
Available
Specificity	Human
Storage Conditions	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Expiration	12 months from the date of shipment when stored properly.
Format	In 1x PBS, pH 7.2
Gene Symbols	PTEN
Protein Name & Synonyms	PTEN
Manufacturer - Specificity	Human
Buffers	1x PBS, pH 7.2
Clonality	Monoclonal

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.