Vergleich

Recombinant Human uPA/PLAU Protein Europäischer Partner

ArtNr RP00652-100ug
Hersteller Abclonal
Menge 100 ug
Quantity options 100 ug 10 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE;> 95% by HPLC
NCBI PLAU/uPA (active form)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLAU,Urokinase,ATF,UPA,URK,u-PA,BDPLT5,QPD
Lieferbar
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
17.9, 29.2, 15.3 kDa
Description
Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu431) of Human uPA/PLAU (Accession #P00749-1) fused with a C-His tag at the C-terminus.
Background
Plasminogen activator, urokinase (uPA) is a secreted serine protease whose Dysregulation is often accompanied by various cancers. PLAU inhibition could suppress tumor growth. Collectively, PLAU is necessary for tumor progression and can be a diagnostic and prognostic biomarker in HNSCC.
Manufacturer - Cross Reactivity
Please contact us for reconstitution instructions.
Immunogen
Ser21-Leu431
Recommended Dilution
Lyophilized from 0.22 μm filtered solution in 1% HCOOH, 1 mM DTT (pH 3.0). Normally 8% trehalose is added as protectant before lyophilization.
Route
C-His
Manufacturer - Research Area
Biosimilar Drug Targets
Antigen Seq
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Protein Formulation
Lyophilized from 0.22 μm filtered solution in 1% HCOOH, 1 mM DTT (pH 3.0). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
17.9, 29.2, 15.3 kDa
Gene Symbol
PLAU/uPA (active form)

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 100 ug
Lieferbar: In stock
lieferbar

Lieferung vsl. bis 29.01.2026 

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen