Comparison

Recombinant Human uPA/PLAU Protein European Partner

Item no. RP00652-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 50 ug
Category
Type Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE;> 95% by HPLC
NCBI PLAU/uPA (active form)
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias PLAU,Urokinase,ATF,UPA,URK,u-PA,BDPLT5,QPD
Available
Manufacturer - Applications
< 1 EU/μg of the protein by LAL method
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
17.9, 29.2, 15.3 kDa
Description
Recombinant Human uPA/PLAU Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser21-Leu431) of Human uPA/PLAU (Accession #P00749-1) fused with a C-His tag at the C-terminus.
Background
Plasminogen activator, urokinase (uPA) is a secreted serine protease whose Dysregulation is often accompanied by various cancers. PLAU inhibition could suppress tumor growth. Collectively, PLAU is necessary for tumor progression and can be a diagnostic and prognostic biomarker in HNSCC.
Manufacturer - Cross Reactivity
Please contact us for reconstitution instructions.
Immunogen
Ser21-Leu431
Recommended Dilution
Lyophilized from 0.22 μm filtered solution in 1% HCOOH, 1 mM DTT (pH 3.0). Normally 8% trehalose is added as protectant before lyophilization.
Route
C-His
Manufacturer - Research Area
Biosimilar Drug Targets
Antigen Seq
SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL
Protein Formulation
Lyophilized from 0.22 μm filtered solution in 1% HCOOH, 1 mM DTT (pH 3.0). Normally 8% trehalose is added as protectant before lyophilization.
Expected Protein Size
17.9, 29.2, 15.3 kDa
Gene Symbol
PLAU/uPA (active form)

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close