« Zurück
Startseite /
Recombinant Mouse CD47 Protein

Recombinant Mouse CD47 Protein

ArtNr	RP00711-100ug
Hersteller	Abclonal
Menge	100 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Oncology Neuroscience Targets for Rodent Neurosciences By Cell Type Hematology Leukemia Lymphoma Peptides & Proteins Recombinant Proteins Cell Biology Cell Movement Cell Adhesion
Typ	Proteins Recombinant
Specific against	Mouse (Murine, Mus musculus)
Purity	> 95% by SDS-PAGE.
NCBI	CD47/IAP/OA3
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	Leukocyte Surface Antigen CD47,Antigenic Surface Determinant Protein OA3,Integrin-AssociatedProtein,IAP,Protein MER6,CD47,MER6
Lieferbar
Manufacturer - Applications	< 0.01 EU/μg
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	39.80 kDa
Description	Recombinant Mouse CD47 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with an Fc tag at the C-terminus.
Background	CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, andC‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	Gln19-Lys140
Recommended Dilution	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Route	C-hFc
Manufacturer - Research Area	Immune Checkpoint
Antigen Seq	QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
Protein Formulation	Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Expected Protein Size	39.80 kDa
Gene Symbol	CD47/IAP/OA3

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP00711-100ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 100 ug

lieferbar

Lieferung vsl. bis 27.11.2025

Express-Lieferung: 1 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern