Comparison

Recombinant Mouse CD47 Protein European Partner

Item no. RP00711-100ug
Manufacturer Abclonal
Amount 100 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Category
Type Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 95% by SDS-PAGE.
NCBI CD47/IAP/OA3
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Leukocyte Surface Antigen CD47,Antigenic Surface Determinant Protein OA3,Integrin-AssociatedProtein,IAP,Protein MER6,CD47,MER6
Available
Manufacturer - Applications
< 0.01 EU/μg
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
39.80 kDa
Description
Recombinant Mouse CD47 Protein is produced by Human Cells expression system. The target protein is expressed with sequence (Gln19-Lys140) of mouse CD47/IAP/OA3 (Accession #Q61735-1) fused with an Fc tag at the C-terminus.
Background
CD47, also known as Integrin‑Associated Protein (IAP) and OA3, is a glycosylated atypical member of theimmunoglobulin superfamily. Mouse CD47 is an integral membrane protein that consists of a extracellulardomain (ECD) with a single Ig‑like domain, five membrane-spanning regions with short intervening loops, andC‑terminal cytoplasmic tail. CD47 has a role in both cell adhesion by acting as an adhesion receptor for THBS1on platelets, and in the modulation of integrins. It plays an important role in memory formation and synapticplasticity in the hippocampus. As a receptor for SIRPA, it binding to which prevents maturation of immaturedendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, it enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cellactivation. It may play a role in membrane transport and/or integrin dependent signal transduction. It alsoprevents premature elimination of red blood cells.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gln19-Lys140
Recommended Dilution
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Route
C-hFc
Manufacturer - Research Area
Immune Checkpoint
Antigen Seq
QLLFSNVNSIEFTSCNETVVIPCIVRNVEAQSTEEMFVKWKLNKSYIFIYDGNKNSTTTDQNFTSAKISVSDLINGIASLKMDKRDAMVGNYTCEVTELSREGKTVIELKNRTVSWFSPNEK
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.
Expected Protein Size
39.80 kDa
Gene Symbol
CD47/IAP/OA3

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100 ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close