ArtNr |
RP00772-50ug |
Hersteller |
Abclonal
|
Menge |
50 ug |
Quantity options |
1000 ug
10 ug
500 ug
50 ug
|
Kategorie |
|
Typ |
Proteins Recombinant |
Specific against |
Mouse (Murine, Mus musculus) |
Purity |
> 97% by SDS-PAGE. |
Sequence |
YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVN |
NCBI |
IL-27 |
ECLASS 10.1 |
32160409 |
ECLASS 11.0 |
32160409 |
UNSPSC |
12352202 |
Alias |
Interleukin-27 subunit alpha,IL27-A,p28,Il27,Il27a,Interleukin-27 subunit beta,Ebi3,IL-27 subunitbeta,IL-27B,Il27b |
Versandbedingung |
Gekühlt |
Lieferbar |
|
Manufacturer - Applications |
< 0.1 EU/μg of the protein by LAL method. |
Manufacturer - Category |
Proteins |
Shipping Temperature |
ice pack |
Storage Conditions |
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week. |
Protein Weight |
48.80 kDa |
Manufacturer - Additional Information |
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Description |
Recombinant Mouse IL-27 Protein is produced by Human cells expression system. The target protein is expressed with sequence (Tyr19-Pro228&Phe29-Ser234) of mouse IL-27 (Accession #O35228&Q8K3I6) fused with a 6×His tag at the C-terminus. |
Background |
IL-27 is a heterodimeric cytokine which belongs to the IL-6/IL-12 family of long type I cytokines. It is expressed onmonocytes, endothelial cells and dendritic cells. IL-27 is an early product of activated antigen-presenting cells and drivesrapid clonal expansion of naive CD4(+) T cells and plays a role in the early regulation of Th1 cells initiation which drivesefficient adaptive immune response. IL-27 has an antiproliferative activity on melanomas through WSX-1/STAT1 signaling.Thus, IL-27 protein may be an attractive candidate as an antitumor agent applicable to cancer immunotherapy. IL-27reveals to be a potent inhibitor of TH17 cell development and of IL-17 production. Indeed IL27 alone is also able to inhibitthe production of IL17 by CD4 and CD8 T-cells. IL-27 has also an effect on cytokine production. It suppressesproinflammatory cytokine production such as IL2, IL4, IL5 and IL6 and activates suppressors of cytokine signaling such asSOCS1 and SOCS3. Apart from suppression of cytokine production, IL-27 also antagonizes the effects of some cytokinessuch as IL6 through direct effects on T-cells. Another important role of IL-27 is its antitumor activity as well as itsantiangiogenic activity with activation of production of antiangiogenic chemokines such as IP-10 and MIG. |
Manufacturer - Cross Reactivity |
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles. |
Immunogen |
Tyr19-Pro228&Phe29-Ser234 |
Route |
C-6×His |
Endotoxin |
< 1 EU/μg of the protein by LAL method. |
Manufacturer - Research Area |
Cytokines & Cytokine Receptors |
Antigen Seq |
YTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDS |
Bioactivity |
Measured in a cell proliferation assay using TF-1 Human erythroleukemic cells. The ED50 for this effect is 0. 24-0. 94 ng/mL, corresponding to a specific activity of 1. 06×106~4. 17×106 units/mg. |
Protein Formulation |
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation. |
Expected Protein Size |
48.80 kDa |
Gene Symbol |
IL-27 |
Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.
Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.