Recombinant Mouse CCL8/MCP-2 Protein

Proteins

Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.

Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.

Chemokine ligand 8 (CCL8, MCP-2), is a small secreted cytokine which belongs to the intercrine beta(chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions toactivate different immune cells, including mast cells, eosinophils and basophils which are involved in allergicresponses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its abilityachieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B andCCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is oneof the major co-receptors for HIV-1.

Gly24-Pro97

< 1 EU/μg of the protein by LAL method.

GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP

9.35 kDa