Vergleich

Recombinant Mouse CCL8/MCP-2 Protein Europäischer Partner

ArtNr RP00773-50ug
Hersteller Abclonal
Menge 50 ug
Quantity options 1000 ug 10 ug 500 ug 50 ug
Kategorie
Typ Proteins Recombinant
Specific against Mouse (Murine, Mus musculus)
Purity > 97% by SDS-PAGE.
Sequence EKLTGPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
NCBI CCL8/MCP-2
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias C-C motif chemokine 8,Ccl8,Monocyte chemoattractant protein 2,Monocyte chemotactic protein2,MCP-2,Small-inducible cytokine A8,Mcp2,Scya8
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
<0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
9.35 kDa
Manufacturer - Additional Information
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid votex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Description
Recombinant Mouse CCL8/MCP-2 Protein is produced by Pichia expression system. The target protein is expressed with sequence (Gly24-Pro97) of mouse CCL8/MCP-2 (Accession #Q9Z121) fused with a 6×His tag at the C-terminus.
Background
Chemokine ligand 8 (CCL8, MCP-2), is a small secreted cytokine which belongs to the intercrine beta(chemokine CC) family. CCL8 Chemotactic factor attracts monocytes. It can bind heparin.CCL8 functions toactivate different immune cells, including mast cells, eosinophils and basophils which are involved in allergicresponses, monocytes, and T cells and NK cells which are involved in the inflammatory response. Its abilityachieves by binding to different cell surface receptors termed chemokine receptors including CCR1, CCR2B andCCR5. It has been reported that CCL8 is a potent inhibitor of HIV-1 by virtue of its binding to CCR5 which is oneof the major co-receptors for HIV-1.
Manufacturer - Cross Reactivity
Centrifuge the tube before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gly24-Pro97
Route
C-6×His
Endotoxin
< 1 EU/μg of the protein by LAL method.
Manufacturer - Research Area
Cytokines & Cytokine Receptors
Antigen Seq
GPDKAPVTCCFHVLKLKIPLRVLKSYERINNIQCPMEAVVFQTKQGMSLCVDPTQKWVSEYMEILDQKSQILQP
Protein Formulation
Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4.Contact us for customized product form or formulation.
Expected Protein Size
9.35 kDa
Gene Symbol
CCL8/MCP-2

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 50 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen