Vergleich

Recombinant Human IFN-gamma Protein Europäischer Partner

ArtNr RP01038-1000ug
Hersteller Abclonal
Menge 1000 ug
Quantity options 1000 ug 100 ug 10 ug 20 ug 500 ug 50 ug 5 ug
Kategorie
Typ Proteins Recombinant
Specific against Human (Homo sapiens)
Purity > 95% by SDS-PAGE.
NCBI IFN-gamma
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias IFNG,IFG,IFI
Versandbedingung Gekühlt
Lieferbar
Manufacturer - Applications
< 0.1 EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Shipping Temperature
ice pack
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
16.78 kDa
Description
Recombinant Human IFN-gamma Protein is produced by E. coli expression system. The target protein is expressed with sequence ( Gln24-Gln166) of human Interferon Gamma (Accession #NP_000610.2).
Background
Interferon-gamma (IFN-gamma ) is a secreted protein which belongs to the type II interferon family.Recombinant Human IFN-gamma is a 16.8 kDa protein containing 143 amino acid residues. IFN-gamma is produced by a variety of immune cells under inflammatory conditions, notably by T cells and NK cells. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. Interferon-gamma is a central regulator of the immune response and signals via the Janus Activated Kinase (JAK)-Signal Transducer and Activator of Transcription (STAT) pathway.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
Gln24-Gln166
Recommended Dilution
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Route
No tag
Manufacturer - Research Area
Cytokines & Cytokine receptors, Cell Culture related, Biosimilar Drug Targets
Antigen Seq
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ
Bioactivity
1. Measured by its binding ability in a functional ELISA. Immobilized Human FNGR1/CD119 at 1 μg/mL (100 μL/well) can bind Human IFNG with a linear range of 0. 98-1. 97 ng/mL.|2. Measured in a cytotoxicity assay using HT-29 cells. The ED50 for this effect is 0. 74-2. 96 ng/mL, corresponding to a specific activity of 3. 38×105~1. 35×106 units/mg. |3. Flow cytometry: 1X106 A549 cells treated with IFN-γ (RP01038, 1 ng/mL) were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human PD-L1/CD274 mAb (A26692, 5 μl/Test, right).4. Flow cytometry: 1X106 NCI-H460 cells treated with IFN-γ (RP01038, 1 ng/mL) were surface-stained with PE Rabbit IgG isotype control (A24172, 5 μl/Test, left) or PE Rabbit anti-Human PD-L1/CD274 mAb (A26692, 5 μl/Test, right)
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.Contact us for customized product form or formulation.
Expected Protein Size
16.78 kDa
Gene Symbol
IFN-gamma

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 1000 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen