Vergleich

Recombinant Human IL-12/IL-12A&IL-12B Protein Europäischer Partner

ArtNr RP01232S-10ug
Hersteller Abclonal
Menge 10 ug
Quantity options 100 ug 10 ug 20 ug 50 ug
Kategorie
Typ Proteins
Specific against Human (Homo sapiens)
NCBI IL12
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias CLMF,IL12,p70,Interleukin-12,IL12A,P35,NKSF
Lieferbar
Manufacturer - Applications
<0.01EU/μg of the protein by LAL method.
Manufacturer - Category
Proteins
Storage Conditions
Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. |After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight
58.38 kDa
Description
Recombinant Human IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)) of Human IL-12/IL-12A&IL-12B (Accession #) fused with a His tag at the C-terminus.
Manufacturer - Cross Reactivity
Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen
IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)
Route
C-His
Manufacturer - Research Area
Cytokines & Cytokine receptors
Antigen Seq
IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Bioactivity
Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is 0. 94-3. 75 ng/mL, corresponding to a specific activity of 2. 67×105~1. 06×106 units/mg.
Protein Formulation
Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size
58.38 kDa
Gene Symbol
IL12

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Menge: 10 ug
Lieferbar: In stock
lieferbar

Vergleichen

Auf den Wunschzettel

Angebot anfordern

Lieferzeit anfragen

Technische Frage stellen

Bulk-Anfrage stellen

Fragen zum Produkt?
 
Schließen