« Zurück
Startseite /
Recombinant Human IL-12/IL-12A&IL-12B Protein

Recombinant Human IL-12/IL-12A&IL-12B Protein

ArtNr	RP01232S-50ug
Hersteller	Abclonal
Menge	50 ug
Quantity options	100 ug 10 ug 20 ug 50 ug
Kategorie	Peptides & Proteins Recombinant Proteins Cell Biology Cell Culture Cytokines
Typ	Proteins
Specific against	Human (Homo sapiens)
NCBI	IL12
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	CLMF,IL12,p70,Interleukin-12,IL12A,P35,NKSF
Lieferbar
Manufacturer - Applications	<0.01EU/μg of the protein by LAL method.
Manufacturer - Category	Proteins
Storage Conditions	Store at -20°C.Store the lyophilized protein at -20°C to -80°C up to 1 year from the date of receipt. \|After reconstitution, the protein solution is stable at -20°C for 3 months, at 2-8°C for up to 1 week.
Protein Weight	58.38 kDa
Description	Recombinant Human IL-12/IL-12A&IL-12B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)) of Human IL-12/IL-12A&IL-12B (Accession #) fused with a His tag at the C-terminus.
Manufacturer - Cross Reactivity	Centrifuge the vial before opening. Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water. Avoid vortex or vigorously pipetting the protein. For long term storage, it is recommended to add a carrier protein or stablizer (e.g. 0.1% BSA, 5% HSA, 10% FBS or 5% Trehalose), and aliquot the reconstituted protein solution to minimize free-thaw cycles.
Immunogen	IL12B(Ile23-Ser328)-3 (GGGGS) IL12A(Arg23-Ser219)
Route	C-His
Manufacturer - Research Area	Cytokines & Cytokine receptors
Antigen Seq	IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSRNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
Bioactivity	Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED₅₀ for this effect is 0. 94-3. 75 ng/mL, corresponding to a specific activity of 2. 67×10⁵~1. 06×10⁶ units/mg.
Protein Formulation	Lyophilized from a 0.22 μm filtered solution of PBS, pH 7.4.
Expected Protein Size	58.38 kDa
Gene Symbol	IL12

Hinweis: Die dargestellten Informationen und Dokumente (Bedienungsanleitung, Produktdatenblatt, Sicherheitsdatenblatt und Analysezertifikat) entsprechen unserem letzten Update und sollten lediglich der Orientierung dienen. Wir übernehmen keine Garantie für die Aktualität. Für spezifische Anforderungen bitten wir Sie, uns eine Anfrage zu stellen.

Alle Produkte sind nur für Forschungszwecke bestimmt. Nicht für den menschlichen, tierärztlichen oder therapeutischen Gebrauch.

Arbeitsanleitung (Data Sheet) anfordern

RP01232S-50ug-datasheet.pdf

Sicherheitsdatenblatt anfordern

Einfache Bestellung Periodische Bestellung

Menge: 50 ug

lieferbar

Lieferung vsl. bis 25.12.2025

Express-Lieferung: 3 Tage sparen

Vergleichen

Auf den Wunschzettel

Angebot anfordern