« Back
Home /
Anti-Human sRANKL (IgG)

Anti-Human sRANKL (IgG)

Item no.	RF0095
Manufacturer	Agrenvec
Amount	100ug
Category	Oncology Antibodies Cell Biology Cell Culture Cytokines Primary Antibodies By Organ Lymphatic System Cancer
Type	Antibody Polyclonal
Clone	Polyclonal-IgG
Specific against	other
Host	Rabbit
ECLASS 10.1	32160702
ECLASS 11.0	32160702
UNSPSC	12352203
Available
Reconstitution & Handling:	Reconstitute in 100ul of sterile water. It is recommended to centrifuge the vial prior opening and gently mix the solution.
Description	Anti-Human sRANKL IgG developed in rabbit and purified by affinity chromatography on protein G (> 98% purity).
Immunogen Name	Highly pure (>97%) recombinant human sRANKL expressed in plants.
Immunogen Sequence	EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPS GSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDG FYYLYANICFRHHETSGDLATEYLQLMVYVTKTSI KIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFK LRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Formulation	Lyophilized from 0.2 um filtered solution in phosphate-saline (PBS) pH 7.4.
Stabilizers & Preservatives:	This product does not contain stabilizers or preservatives.
WB	Suggested starting dilution 1/1000. Anti-rabbit IgG-AP (alkaline phosphatase conjugate) is recommended as secondary reagent.
ELISA	Suggested starting dilution 1/1000. This antibody, in conjunction with compatible secondary reagent (anti-rabbit IgG-AP conjugate), allows the detection of 0.2-1 ng/well of rhuman sRANKL (RF0038).
NEUTRALIZATION	No data available.
Storage and Stability:	This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping	Room temperature

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 100ug

available

Delivery expected until 9/18/2025

Express Delivery: Save 13 days

Compare

Add to wishlist

Get an offer