Comparison

Recombinant Human Interleukin-12p40 European Partner

Item no. RF0031-10
Manufacturer Agrenvec
Amount 10ug
Category
Type Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias Interleukin 12B (natural killer cell stimulatory factor 2, cytotoxic lymphocyte maturation factor 2, p40), CLMF, CLMF2, IL-12B, NKSF, NKSF2
Available
Molecular Weight:
Recombinant human Interleukin-12 p40 is a glycosylated polypeptide chain containing 312 amino acids ( fragment 23 - 328 P29460 IL12B_HUMAN) with an amino- terminal hexahistidine tag. The recombinant protein has a predicted molecular mass of 35.5kDa, however as a result of potential glycosylation, the molecular mass could be approximately 40kDa by SDSPAGE under reducing conditions.
Molecular Formula:
C1575H2420N424O490S12
p.I:
5, 91
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
2069
UniProtKB:
P29460
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Interleukin-12 (IL-12) is a heterodimer cytokine composed of p40 and p35 subunits. It is mainly produced by macrophages, dendritic cells, and B cells. It has multiple effects on T and natural killer (NK) cells. In particular it appears to be a major factor for the development of cellular immunity. IL-12 stimulates the production and secretion of several cytokines, in particular IFN-gamma, by NK cells and T cells, induces proliferation and enhances the cytotoxic activity within these cell populations. The p40 subunit of IL-12 interacts with the beta subunit of IL-12R and the disulphide linked p40 homodimer specifically antagonize the activity of bioactive IL-12 in different assay systems.
Sequence:
HHHHHHIWELKKDVYVVELDWYPDAPGEMVVLTCD TPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAG QYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQK EPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSV KSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSV ECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSS FFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDT WSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSA TVICRKNASISVRAQDRYYSSSWSEWASVPCS
Formulation:
Recombinant human Interleukin-12p40 is lyophilized from 10mM PBS buffer pH 7.6 and 0.2 M NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
SDS-PAGE, Western Blot, Antibody Production.
Bioassay 1 - Result assay 1:
The biological activity of IL12 p40 is determined by the dose dependent inhibition of IL-12 dependent IFN-gamma production (mouse splenocytes). - Not available.
Bioassay 2 - Result assay 2:
-
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
-Gee K, et al. (2009) The IL-12 family of cytokines in infection, inflammation and autoimmune disorders. , Mars 8(1):40-52. -Trinchieri, G. (1998) Interleukin 12: a cytokine at the interface of inflame and immunity. Adv. Immunolog., 70: 83-243 -Gillessen, S. et al. (1995) Mouse interleukine-12 (IL-12)p40 homodimer: a potent IL-12 antagonist. Eur. Immunolog, 25:200-206. -Gately, M. K., et al. (1998) The inteleukine-12/interleukine-12 receptor system: role in normal and pathologic immune responses. Annu. Rev. Immunol, 16:495-521 -D'Andrea, A. et al. (1992) Production of natural killer cell stimulatory factor (interleukin 12) by peripheral blood mononuclear cells. J. Exp. Med., 176: 1387-1398. -Chan, S. H. et al. (1991). Induction of interferon gamma production by natural killer cell stimulatory factor: characterization of the responder cells and synergy with other inducers. J. Exp Med., 173:869-879 -Wolf, S. F. et al. (1991) Cloning of cDNA for natural killer cell stimulatory factor, a heterodimeric cytokine with multiple biologic effects on T and natural killer cells. J. Immunol., 146: 3074-3081.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1ug, 5ug, 10ug, 20ug, 100ug

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 10ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close