Comparison

Active Recombinant Human sRANK Ligand European Partner

Item no. RF0063-100
Manufacturer Agrenvec
Amount 100ug
Category
Type Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias TNFSF11, OPGL, TRANCE
Available
Molecular Weight:
Recombinant human sRANKL is a glycosylated polypeptide chain containing 175 amino acids (70 – 244 aa of O14788 TNF11_HUMAN) and a His-tag at the N-terminal end. It has a predicted molecular mass of 21.1 kDa, however as result of glycosylation, the recombinant protein could migrate as two bands with an apparent molecular mass of 21-23 kDa in SDSPAGE.
Molecular Formula:
C952H1414N262O276S5
p.I:
6.82
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
1678
UniProtKB:
O14788
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Recombinant human RANKL is a member of TNF super family, a cytokine that play a central role in bone remodeling and disorders of mineral metabolism. It was shown to be a dendritic cell survival factor, T-cell activator and osteoclast regulator because RANKL mediates the osteoclast differentiation, survival and activation. Native RANKL is a type II trans-membrane protein with an extracellular binding domain that interacts with RANK and OPG receptors. OPG protects the skeleton from excessive bone resorption by binding to RANKL and preventing it from binding to its receptor, RANK. Thus, RANKL/OPG ratio became an important determinant of bone mass and skeletal integrity. In addition, this protein was shown to activate anti-apoptotic kinase AKT/PKB through a signalling complex involving SRC kinase and tumour necrosis factor receptor-associated factor (TREAF). Recent findings shown that OPG/RANK/RANKL system has been identifies as a possible mediator of arterial calcification suggesting common links between osteoporosis and vascular diseases.
Sequence:
HHHHHHHHHHEKAMVDGSWLDLAKRSKLEAQPFAH LTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFS NGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQ LMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHF YSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATY FGAFKVRDID
Formulation:
Recombinant human RANKL is lyophilized from 10mM Phosphate Potasium buffer pH 8 and 0.2M NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell Culture, Western Blot, Immunogen.
Bioassay 1 - Result assay 1:
The specific activity is determined by the dose-dependent stimulation of IL-8 production in human PBMC. Activity results may vary with PBMC donors. - Human PBMC stimulated with 10ng/ml of Human recombinant sRANKL increases in three times the basal production of IL-8.
Bioassay 2 - Result assay 2:
-
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
- Anderson, D. et al., 1997. A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function. Nature 390: 175-179 - Takahashi, N. et al., 1999. A new member of tumour necrosis factor ligand family, ODF/OPGL/TRANCE/RANKL, regulates osteoclast differentiation and function. Biochem Biophys. Res. Common. Mar 24, 256(3):449-55. - Yasuda, H. et al., 1998. Osteoclast differentiation factor is a ligand for osteoprotegerin/osteoclastogenesis-inhibitory factor and is identical to TRANCE/RANKL. Proc. Natl. Acad. Sci. USA 95:3597-3602. - D'Amelio, P. et al., 2009. The osteoprotegerin/RANK/RANKL system: a bone key to vascular disease.J Endocrinol Invest. 32(4 Suppl):6-9. - Suda, T. et al., 1999. Modulation of osteoclast differentiation and function by de the new members of the tumour necrosis factor receptor and ligand family. Endocr. Rev.20:345-350.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 200 ng/ul. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 50 ug, 100 ug of active protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close