Comparison

Active Recombinant Human VEGF 165a European Partner

Item no. RF0104-100
Manufacturer Agrenvec
Amount 100ug
Category
Type Proteins Recombinant
Specific against other
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias VEGF-A, Vascular permeability factor, VPF
Available
Molecular Weight:
Recombinant full length VEGF is a 38.2 kDa homodimeric protein consisting of two 165 amino acid polypeptide chains (amino acids 27-191 P15692-4 VEGFA_HUMA) with His tag at N-terminal.
Molecular Formula:
C854H1340N274O257S22
p.I:
7, 65
Ext. Coeff. Abs (280nm) 0.1% (=1g/l) =
0.343
UniProtKB:
P15692
Endotoxin level:
Endotoxin Level : < 0.04 EU / ug protein (LAL method)
Source:
Human recombinant protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants. This product contains no animal–derived components or impurities. Animal Free product.
Description:
Vascular endothelial growth factor is a member of the platelet-derived growth factor family. It is a specific mitogen for vascular endothelial cells in vitro and a strong angiogenic factor in vivo. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Expressed in vascularized tissues, VEGF plays a prominent role in normal and pathological angiogenesis. In addition to its action as a mitogen it is a potent vascular permeability factor (VPF) in vivo and is also a chemo attractant for monocytes cells. VEGF binds to the FLT1/VEGFR1 and KDR/VEGFR2 present on endothelial cells. Substantial evidence implicates VEGF in the induction of tumour metastasis by stimulating the production of matrix metalloproteinase (MMPs).
Sequence:
HHHHHHHHAPMAEGGGQNHHEVVKFMDVYQRSYCH PIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCN DEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFL QHNKCECRPKKDRARQENPCGPCSERRKHLFVQDP QTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Formulation:
Recombinant human VEGF is lyophilized from 10mM Phosphate Potasium buffer pH 7.5 and 100 mM NaCl.
Purity
Purity >97% by SDS-PAGE gel
Applications:
Functional studies, Cell assay, SDS-PAGE, Western Blot, Antibody Production.
Bioassay 1 - Result assay 1:
1.The specific activity is determined by the dose-dependent stimulation of the proliferation of human umbilical vein endothelial cells (HUVEC). - ED50 1-2 ng/ml
Bioassay 2 - Result assay 2:
2. Recombinant human VEGF 165a shows effect on kerotinocytes cell proliferation (HaCaT cells).The activity is determined by the dose-dependent stimulation of the cell proliferation 48 hours after treatment with recombinant protein. Cell viability was assessed by MTT . - It was observed 30% of cell proliferation with a concentration ?5ng/ml.
Bioassay 3 - Result assay 3:
-
Bioassay 4 - Result assay 4:
-
References:
- Ferrara, N., 1999. Molecular and Biological properties of vascular endothelial growth factor. J. Mol. Med., 77 () 527-543. - Detmar, M., 2000. The role of VEGF and thrombospondins in skin Angiogenesis. Journal of Dermatological Science, 24 Suppl. 1 S78–S84. - Ferrara, N., 2001. Role of vascular endothelial growth factor in regulation of Physiological angiogenesis. Am. J.Physiol. Cell Physiol., 280 C1358-C1366. - Bao, P. et al., 2009. The role of vascular endothelial growth factor in wound healing. J Surg Res., 153(2):347-58.
RESCONSTITUTION RECOMENDATION QC SHEET
Centrifuge vial before opening. Lyophilized protein should be reconstituted in water to a concentration of 100 ng/ul. When reconstituting the product, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. Optimal concentration should be determined for specific application and cell lines.
Storage and Stability:
This lyophilized preparation is stable at 2-8C C for short term, long storage it should be kept at -20C. Reconstituted protein should be stored in working aliquots at –20C. Repeated freezing and thawing is not recommended.
Shipping
Room temperature
Available sizes (ug) :
1 ug, 10 ug, 100 ug, 250 ug of active protein

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 100ug
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close