« Back
Home /
Easy blot Mini YKit Follistatina

Easy blot Mini YKit Follistatina

Item no.	RF0082
Manufacturer	Agrenvec
Amount	1
Category	Other Assays & Kits Detection Kits
Type	Detection Kits
Specific against	other
ECLASS 10.1	32161090
ECLASS 11.0	32161090
UNSPSC	41116126
Available
Description	Serologic qualitative detection of rh Follistatin using Anti-Human Follistatin IgG developed in rabbit and purified by affinity chromatography on protein G (> 98% purity).
Packaging	Anti-Human Follistatin (IgG). Polyclonal-IgG 100 ug lyophilized (RF0060)
	Recombinant Human Follistatin Active 1 ug lyophilized. Positive Control (RF0043)
Immunogen Name	Highly pure (>97%) recombinant human Follistatin expressed in plants.
Immunogen Sequence	GNCWLRQAKNGRCQVLYKTELSKEECCSTGRLSTS WTEEDVNDNTLFKWMIFNGGAPNCIPCKETCENVD CGPGKKCRMNKKNKPRCVCAPDCSNITWKGPVCGL DGKTYRNECALLKARCKEQPELEVQYQGRCKKTCR DVFCPGSSTCVVDQTNNAYCVTCNRICPEPASSEQ YLCGNDGVTYSSACHLRKATCLLGRSIGLAYEGKC IKAKSCEDIQCTGGKKCLWDFKVGRGRCSLCDELC PDSKSDEPVCASDNATYASECAMKEAACSSGVLLE VKHSGSCN
Formulation	Lyophilized
Positive Control	Recombinant Human Follistatin Active RF0043. Lyophilized protein should be reconstituted in water to a concentration of 50 ng/ul. Use 100-200 ng by assay Due to the protein nature dimmers and multimers may be observed.
Stabilizers & Preservatives:	This product does not contain stabilizers or preservatives.
WB	Suggested starting dilution 1/500 anti-rabbit IgG-AP (alkaline phosphatase conjugate) is recommended as secondary reagent.
ELISA	Suggested starting dilution 1/500. This antibody, in conjunction with compatible secondary reagent (anti-rabbit IgG-AP conjugate), allows the detection of <10 ng/well of rhuman Follistatin (RF0043).
NEUTRALIZATION	No data available.

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

Request safety datasheet

Simple Order Order Subscription

Amount: 1

available

Delivery expected until 12/18/2025

Express Delivery: Save 29 days

Compare

Add to wishlist

Get an offer