Comparison

PACAP (1-38), amide, human, ovine, rat

Item no. AS-22520
Manufacturer AnaSpec
CASRN 124123-15-5
Amount 1 mg
Category
Type Peptides
Format Lyophilized
Specific against other
Conjugate/Tag Unconjugated
Purity Peak Area by HPLC ≥95%
Sequence H-His-Ser-Asp-Gly-Ile-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2
Citations Ref: Miyata, A. et al. BBRC 173, 1271 (1990).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Shipping Condition Room temperature
Available
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Pituitary adenylate cyclase-activating polypeptide (PACAP)
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
4534.5
Manufacturer - Research Area
Hormones; Cell Signaling / Hypothalamo-Pituitary (HPA) Axis; GPCR
Description
Pituitary adenylate cyclase-activating polypeptide (PACAP), a member of the vasoactive intestinal peptide/secretin/glucagon family, has an amino acid sequence identity of 68% with vasoactive intestinal polypeptide (VIP). PACAP38, derived from a 176-amino acid precursor (preproPACAP), is a 38-amino acid peptide discovered as an ovine hypothalamic neuropeptide. The amino acid sequence of PACAP is identical in all mammals, and in species such as chicken, frog, salmon, only 1–3 amino acids are different. It is abundant in both the central and peripheral nervous systems and exerts a variety of effects. PACAP in pancreatic islets may play a parasympathetic and sensory neurotransmitter role. PACAP stimulates insulin secretion from islets in a glucose-dependent manner at femtomolar concentrations, acting as an insulinotropic factor. PACAP and VIP are two multifunctional neuropeptides modulating innate and adaptive immunity. VIP/PACAP protect T cells from activation-induced cell death through down-regulation of Fas ligand. PACAP immunoreactivity has been shown in nerve fibers innervating the intrapancreatic ganglia as well as the islets of Langerhans in pancreas. PACAP (1-38) is more active than VIP in stimulating adenylate cyclase (EC50=7 nM).
Sequence One-Letter Code
HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535046538

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close