« Back
Home /
Growth Hormone Releasing Factor, GRF (1-29), amide, human - 1 mg

Growth Hormone Releasing Factor, GRF (1-29), amide, human - 1 mg

Item no.	AS-22875
Manufacturer	AnaSpec
Amount	1 mg
Category	Neuroscience Metabolism Diabetes Molecular Targets for Neuroscience Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2
Citations	Ling, N. et al. Proc Natl Acad Sci USA 81, 4302 (1984)Gaudreau, P. et al. J Med Chem 35, 1864 (1992), doi: 10.1021/jm00088a023 Lance, VA. et al. Biochem Biophys Res Commun 119, 265 (1984), doi: 10.1016/0006-291X(84)91647-4 Lapierre, H. et al. Domest Anim Endocrinol 4, 207 (1987) Mayo, KE. et al. Nature 306, 86 (1983)Rivier, J. et al. Nature 300, 276 (1982), doi:10.1038/300276a0Grossman, A. et al. Clin Endocrinol (Oxf) 21, 321 (1984)
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Growth Hormone Releasing Factor (GRF, GHRH)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3358.1
Description	This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure-activity studies show that hpGRF(1-29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (<93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Product Group	LB1A1Z
Research Area	Hormones / Lyophilized
Sequence One-Letter Code	YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
GTIN	5400535045951
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-22875-safety-datasheet.pdf