« Back
Home /
Corticotropin Releasing Factor, CRF, ovine

Corticotropin Releasing Factor, CRF, ovine

Item no.	AS-22932
Manufacturer	AnaSpec
CASRN	79804-71-0
Amount	0.5 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ser-Gln-Glu-Pro-Pro-Ile-Ser-Leu-Asp-Leu-Thr-Phe-His-Leu-Leu-Arg-Glu-Val-Leu-Glu-Met-Thr-Lys-Ala-Asp-Gln-Leu-Ala-Gln-Gln-Ala-His-Ser-Asn-Arg-Lys-Leu-Leu-Asp-Ile-Ala-NH2
Citations	Ref: Vale, W. et al. Science 213, 1394 (1981).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	Corticotropin-Releasing Factor (CRF)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4670.7
Manufacturer - Research Area	Hormones; Cell Signaling / Hypothalamo-Pituitary (HPA) Axis; GPCR
Description	The peptide, corticotropin releasing factor (CRF) was first isolated in the mammalian brain that regulates the hypothalamic-pituitary-adrenocortical axis. It also plays a key role in modulating the endocrine, autonomic, and behavioral responses to stress and cardiovascular, gastrointestinal, and immune activities.
Sequence One-Letter Code	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHSNRKLLDIA-NH2
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535045821

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-22932-safety-datasheet.pdf