« Back
Home /
Gastrin Releasing Peptide, human - 0.5 mg

Gastrin Releasing Peptide, human - 0.5 mg

Item no.	AS-24213
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Oncology Peptides & Proteins Peptides By Organ Lung Cancer
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2
Citations	Kamata, K. et al. Nephrol Dialysis Transplant 11, 1267 (1996), doi: 10.1093/ndt/11.7.1267Tache, Y. et al. Gastroenterol 81, 298 (1981) Siegfried, J. et al. J Biol Chem 269, 8596 (1994)Patel, O. et al. Biochem Pharmacol 68, 2129 (2004), doi: 10.1016/j.bcp.2004.08.009Niederle, B. Wien Klin Wochenschr 119, 561 (2007), doi: 10.1007/s00508-007-0897-x.
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Gastrin Releasing Peptide
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	2859.6
Description	Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, stimulates the release of Gastrin, and shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells.
Product Group	LB1A1Z
Research Area	Hormones; Cell Signaling; Cancer & Apoptosis / Lyophilized
Sequence One-Letter Code	VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2
GTIN	5400535040642
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24213-safety-datasheet.pdf