« Back
Home /
Beta-Amyloid (1-40) Peptide

Beta-Amyloid (1-40) Peptide

Item no.	AS-24236
Manufacturer	AnaSpec
CASRN	131438-79-4
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH
Citations	Ref: Masters, CL. et al. Proc. Natl. Acad. Sci. USA 82, 4245 (1985); Yankner, BA. Neuron 16, 921 (1996); Geula, C. et al. Nat. Med. 4, 827 (1998); Shin, R. et al. J. Neurosci.17, 8187 (1997).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (1-40)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4330.2
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	A? (1-40) together with A? (1-42) are two major C-terminal variants of the A? protein constituting the majority of A?s. These undergo post-secretory aggregation and deposition in the Alzheimer’s disease brain. Electron microscopy of ?-amyloid (1-40) stained with Thioflavin T (data generated by an AnaSpec scientist).
Sequence One-Letter Code	DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535040451

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24236-safety-datasheet.pdf