« Back
Home /
Peptide YY, human - 0.5 mg

Peptide YY, human - 0.5 mg

Item no.	AS-24401
Manufacturer	AnaSpec
Amount	0.5 mg
Category	Neuroscience Metabolism Regulation of Appetite Molecular Targets for Neuroscience Peptides & Proteins Obesity Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Purity	Peak Area by HPLC ≥95%
Sequence	H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2
Citations	Ref: Tatemoto, K. et al. BBRC 157, 713 (1988); Hallden, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Peptide YY
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4310
Description	PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Product Group	LB1A1Z
Research Area	Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
GTIN	5400535039981
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-24401-safety-datasheet.pdf