« Back
Home /
Beta-Amyloid (4-42)

Beta-Amyloid (4-42)

Item no.	AS-29908-1
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Ref: Lalowski, M. et al. J. Biol. Chem. 271, 33623 (1996).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (X-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4199.1
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	N-truncated A?4-42 is highly abundant in Alzheimer disease (AD) brain and was the first A? peptide discovered in AD plaques. A?4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence One-Letter Code	FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535021368

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-29908-1-safety-datasheet.pdf