« Back
Home /
Beta-Amyloid (2-42)

Beta-Amyloid (2-42)

Item no.	AS-29909-1
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH
Citations	Ref: Wiltfang, J. et al. J. Biol. Chem. 276, 42645 (2001).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	beta-amyloid, beta-amyloid (X-42)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4399.3
Manufacturer - Research Area	Neuroscience / Alzheimer's Disease
Description	This peptide is beta-amyloid (1-42) N-terminally truncated. It was shown that supplementing the media with N-terminally truncated Abeta (2-40) and (2-42) induce the phagocytosis of polystyrene particles by primary human monocytes. N-terminally truncated A?(x–42) induced the phagocytosis of PSPs significantly more effectively than did A?(x–40).
Sequence One-Letter Code	AEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535021344

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-29909-1-safety-datasheet.pdf