Comparison

hBD-1, b-Defensin-1, human

Item no. AS-60740
Manufacturer AnaSpec
Amount 0.1 mg
Category
Type Peptides
Format Lyophilized
Specific against other
Conjugate/Tag Unconjugated
Purity Peak Area by HPLC ≥95%
Sequence H-Asp-His-Tyr-Asn-Cys-Val-Ser-Ser-Gly-Gly-Gln-Cys-Leu-Tyr-Ser-Ala-Cys-Pro-Ile-Phe-Thr-Lys-Ile-Gln-Gly-Thr-Cys-Tyr-Arg-Gly-Lys-Ala-Lys-Cys-Cys-Lys-OH (Disulfide bridge: 5-34, 12-27, 17-35)
Citations Niyonsaba F and Ogawa H. J Derm Sci. 40, 157-168 (2005).
ECLASS 10.1 32160409
ECLASS 11.0 32160409
UNSPSC 12352202
Alias DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK (Disulfide bridge: 5-34,12-27,17-35)
Shipping Condition Room temperature
Available
Manufacturer - Category
Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets
Defensin
Shipping Temperature
RT
Storage Conditions
- 20 °C
Molecular Weight
3928.7
Manufacturer - Research Area
Immunology and Infectious disease / Microbiology/Bacteriology
Description
Defensins are small cysteine-rich cationic proteins found in both vertebrates and invertebrates. They have host defense properties, and are active against bacteria, fungi and many viruses. Beta-defensins are the most widely distributed, being secreted by leukocytes and epithelial cells of many kinds.
This peptide (3.9kDa, 36-amino acids) has a beta sheet with three intramolecular disulfide bonds. It is constitutively produced by various epithelial tissues including urogenital and respiratory tracts. Its expression is also inducible in keratinocytes of whole human skin by lipopolysaccharides and peptidoglycan. hBD-1 exhibits antimicrobial activity against several pathogenic microorganisms including E.coli, although its activity is dependent on salt sensitivity, because it is inhibited by salt in a concentration-dependent manner. In addition to its antimicrobial activity, hBD-1 chemoattracts CC chemokine receptor (CCR)6-expressing HEK293 cells, implying that this peptide utilizes CCR6 as a receptor.
Sequence One-Letter Code
DHYNCVSSGGQCLYSACPIFTKIQGTCYRGKAKCCK(Disulfide bridge: 5-34, 12-27, 17-35)
Post Synthesis Coupling
No
Usage
Research use
UNSPSC
12352202
GTIN
5400535156817

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Amount: 0.1 mg
Available: In stock
available

Compare

Add to wishlist

Get an offer

Request delivery time

Ask a technical question

Submit a bulk request

Questions about this Product?
 
Close