« Back
Home /
Chlorotoxin (Cltx) - 0.1 mg

Chlorotoxin (Cltx) - 0.1 mg

Item no.	AS-60770
Manufacturer	AnaSpec
Amount	0.1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Met-Cys-Met-Pro-Cys-Phe-Thr-Thr-Asp-His-Gln-Met-Ala-Arg-Lys-Cys-Asp-Asp-Cys-Cys-Gly-Gly-Lys-Gly-Arg-Gly-Lys-Cys-Tyr-Gly-Pro-Gln-Cys-Leu-Cys-Arg-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Citations	Ref: DeBin, JA. and GR. Strichartz, Toxicon 29, 1403 (1991); DeBin, JA. et al. Am. J. Physiol. 264, C361 (1993).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	Chlorotoxin (Cltx)
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3995.9
Description	A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Product Group	LB1A2Z
Research Area	Cell Signaling / Lyophilized
Sequence One-Letter Code	MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19, 5-28, 16-33, 20-35)
GTIN	5400535156671
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-60770-safety-datasheet.pdf