« Back
Home /
GIP (3-42), human - 1 mg

GIP (3-42), human - 1 mg

Item no.	AS-61227
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Glu-Gly-Thr-Phe-Ile-Ser-Asp-Tyr-Ser-Ile-Ala-Met-Asp-Lys-Ile-His-Gln-Gln-Asp-Phe-Val-Asn-Trp-Leu-Leu-Ala-Gln-Lys-Gly-Lys-Lys-Asn-Asp-Trp-Lys-His-Asn-Ile-Thr-Gln-OH
Citations	Gault, VA. et al. Endocrinol 175, 525 (2002), doi: 10.1677/joe.0.1750525
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4749.6
Description	This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Product Group	LB1A1Z
Research Area	Diabetes/Metabolism; Hormones; Cell Signaling / Lyophilized
Sequence One-Letter Code	EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
GTIN	5400535154530
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-61227-safety-datasheet.pdf