« Back
Home /
LL-37, Antimicrobial Peptide, human - 1 mg

LL-37, Antimicrobial Peptide, human - 1 mg

Item no.	AS-61302
Manufacturer	AnaSpec
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Leu-Leu-Gly-Asp-Phe-Phe-Arg-Lys-Ser-Lys-Glu-Lys-Ile-Gly-Lys-Glu-Phe-Lys-Arg-Ile-Val-Gln-Arg-Ile-Lys-Asp-Phe-Leu-Arg-Asn-Leu-Val-Pro-Arg-Thr-Glu-Ser-OH
Citations	Dürr, UHN. et al. Biochim. Biophys. Acta 1758, 1408 (2006); Neville, F. et al. Biophys. J. 90, 1275 (2006); Oren, Z. et al. Biochem. J. 341, 501(1999).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	[LL-37, 37 aa]
Shipping Condition	Room temperature
Available
Manufacturer - Type	Catalog
Manufacturer - Category	Peptides
Manufacturer - Targets	LL-37
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	4493.6
Description	Antimicrobial peptide LL-37, belongs to the cathelicidin family of peptides, and this peptide corresponds to the sequence of the first amphipathic alpha-helical peptide isolated from human. It plays an important role in the first line of defense against local infection and systemic invasion of pathogens at sites of inflammation and wounds. Cytotoxic to both bacterial and normal eukaryotic cells , LL-37 is significantly resistant to proteolytic degradation in solution.
Product Group	LB1A1Z
Research Area	Immunology and Infectious disease; Cell Signaling / Lyophilized
Sequence One-Letter Code	[LL-37, 37 aa]
GTIN	5400535154196
Usage	Research use
UNSPSC	12352202

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-61302-safety-datasheet.pdf