« Back
Home /
CRAMP, mouse

CRAMP, mouse

Item no.	AS-61305
Manufacturer	AnaSpec
CASRN	376364-36-2
Amount	1 mg
Category	Peptides & Proteins Peptides
Type	Peptides
Format	Lyophilized
Specific against	other
Conjugate/Tag	Unconjugated
Purity	Peak Area by HPLC ≥95%
Sequence	H-Gly-Leu-Leu-Arg-Lys-Gly-Gly-Glu-Lys-Ile-Gly-Glu-Lys-Leu-Lys-Lys-Ile-Gly-Gln-Lys-Ile-Lys-Asn-Phe-Phe-Gln-Lys-Leu-Val-Pro-Gln-Pro-Glu-Gln-OH
Citations	Limura, M. et al. J. Immunol. 174, 4901 (2005); Lopez-Garcia, B. et al. J. Invest. Dermatol. 125, 108 (2005).
ECLASS 10.1	32160409
ECLASS 11.0	32160409
UNSPSC	12352202
Alias	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Shipping Condition	Room temperature
Available
Manufacturer - Category	Catalog Peptides / Catalog Peptides Gr / Peptides
Manufacturer - Targets	CRAMP
Shipping Temperature	RT
Storage Conditions	- 20 °C
Molecular Weight	3878.9
Manufacturer - Research Area	Immunology and Infectious disease; Cell Signaling / Microbiology/Bacteriology; GPCR
Description	This cathelicidin-related antimicrobial peptide (mCRAMP) is the sole murine cathelicidin. mCRAMP expression in the intestinal tract is restricted to surface epithelial cells in the colon. mCRAMP shows antimicrobial activity against the murine enteric pathogen Citrobacter rodentium and destroys skin Candida albicans.
Sequence One-Letter Code	GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
Post Synthesis Coupling	No
Usage	Research use
UNSPSC	12352202
GTIN	5400535154172

Note: The presented information and documents (Manual, Product Datasheet, Safety Datasheet and Certificate of Analysis) correspond to our latest update and should serve for orientational purpose only. We do not guarantee the topicality. We would kindly ask you to make a request for specific requirements, if necessary.

All products are intended for research use only (RUO). Not for human, veterinary or therapeutic use.

Request Data Sheet

Request product datasheet

AS-61305-safety-datasheet.pdf